MA309B
|
Anti-Acetyl Histone H3 (Lys27), mouse monoclonal antibody |
100 uL |
USD $564.00
|
|
|
|
Anti-histone antibodies for the study of histone modifications related to epigenetic analysis. These antibodies may be used for chromatin immunoprecipitation (ChIP) assays.
Notice to purchaser
Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.
|
MA305B
|
Anti-Acetyl Histone H3 (Lys9), mouse monoclonal antibody |
100 uL |
USD $564.00
|
|
|
|
Anti-histone antibodies for the study of histone modifications related to epigenetic analysis. These antibodies may be used for chromatin immunoprecipitation (ChIP) assays.
Notice to purchaser
Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.
|
MA310B
|
Anti-Acetyl Histone H3 (Lys9/27), mouse monoclonal antibody |
100 uL |
USD $554.00
|
|
|
|
Anti-histone antibodies for the study of histone modifications related to epigenetic analysis. These antibodies may be used for chromatin immunoprecipitation (ChIP) assays.
Notice to purchaser
Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.
|
MA332B
|
Anti-Dimethyl Histone H3 (Lys36), Mouse Monoclonal Antibody |
100 uL |
USD $543.00
|
|
|
|
Anti-histone antibodies for the study of histone modifications related to epigenetic analysis. These antibodies may be used for chromatin immunoprecipitation (ChIP) assays.
Notice to purchaser
Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.
|
MA303B
|
Anti-dimethyl Histone H3 (Lys4), mouse monoclonal antibody |
100 uL |
USD $554.00
|
|
|
|
Anti-histone antibodies for the study of histone modifications related to epigenetic analysis. These antibodies may be used for chromatin immunoprecipitation (ChIP) assays.
Notice to purchaser
Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.
|
MA307B
|
Anti-Dimethyl Histone H3 (Lys9), mouse monoclonal antibody |
100 uL |
USD $543.00
|
|
|
|
Anti-histone antibodies for the study of histone modifications related to epigenetic analysis. These antibodies may be used for chromatin immunoprecipitation (ChIP) assays.
Notice to purchaser
Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.
|
MA301B
|
Anti-Histone H3 (mouse), Monoclonal |
100 uL |
USD $543.00
|
|
|
|
An anti-histone antibody for the study of histone modifications related to epigenetic analysis. This antibody can be used for chromatin immunoprecipitation (ChIP) assays. Histone H3 antibodies were generated via a 13-amino acid peptide on N-terminal human histone H3.1.
Notice to purchaser
Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.
|
M232
|
Anti-Human Insulin C, Monoclonal (Clone h-Ins 1B-1) |
0.1 mg |
USD $515.00
|
|
|
|
Monoclonal antibody was obtained by fusing the mouse myeloma cell line P3U1 with spleen cells of C57BL/6 mouse after immunization with KLH-conjugated peptide from human insulin C-peptide sequence (71–86) [GPGAGSLQPLALEGSL]. The monoclonal antibody was harvested from ascitic fluid of a SCID mouse.
Notice to purchaser
Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.
|
MA321B
|
Anti-Monomethyl Histone H3 (Lys27), Mouse Monoclonal Antibody |
100 uL |
USD $543.00
|
|
|
|
Anti-histone antibodies for the study of histone modifications related to epigenetic analysis. These antibodies may be used for chromatin immunoprecipitation (ChIP) assays.
Notice to purchaser
Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.
|
MA331B
|
Anti-Monomethyl Histone H3 (Lys36), Mouse Monoclonal Antibody |
100 uL |
USD $497.00
|
|
|
|
Anti-histone antibodies for the study of histone modifications related to epigenetic analysis. These antibodies may be used for chromatin immunoprecipitation (ChIP) assays.
Notice to purchaser
Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.
|
MA302B
|
Anti-Monomethyl Histone H3 (Lys4), mouse monoclonal antibody |
100 uL |
USD $554.00
|
|
|
|
An anti-histone antibody for the study of histone modifications related to epigenetic analysis. This antibody can be used for chromatin immunoprecipitation (ChIP) assays. Histone H3 antibodies were generated via a 13-amino acid peptide on N-terminal human histone H3.1.
Notice to purchaser
Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.
|
MA306B
|
Anti-Monomethyl Histone H3 (Lys9), mouse monoclonal antibody |
100 uL |
USD $554.00
|
|
|
|
Anti-histone antibodies for the study of histone modifications related to epigenetic analysis. These antibodies may be used for chromatin immunoprecipitation (ChIP) assays.
Notice to purchaser
Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.
|
M234
|
Anti-Mouse Albumin, Monoclonal (Clone M-Alb 151-1) |
0.1 mg |
USD $449.00
|
|
|
|
Antibody for detection of albumin: Monoclonal antibody was obtained by fusing the mouse myeloma cell-line P3U1 with lymph cells from an SD rat after immunization with purified albumin from mouse plasma. The monoclonal antibody was harvested from the clone's culture supernatant in serum free medium.
Notice to purchaser
Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.
|
M233
|
Anti-Mouse Insulin C, Monoclonal (Clone M-Ins 1J-4) |
0.1 mg |
USD $515.00
|
|
|
|
Monoclonal antibody was obtained by fusing the mouse myeloma cell line P3U1 with spleen cells of SD rat after immunization with KLH-conjugated peptide from mouse insulin C-peptide sequence (71–84) [SPGDLQTLALEVAR]. The monoclonal antibody was harvested from ascitic fluid of a SCID mouse.
Notice to purchaser
Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.
|
M178
|
Anti-Mouse Insulin C, Polyclonal |
0.1 mg |
USD $515.00
|
|
|
|
This antibody is suitable for studies on the structure, function, and metabolism of insulin.
Notice to purchaser
Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.
|
M230
|
Anti-Mouse Irx3, Polyclonal |
0.2 mg |
USD $554.00
|
|
|
|
Antibody to neural progenitor cells; detects neurogenesis biomarkers. Use for embryogenesis and stem cell research. This is a rabbit polyclonal antibody raised against C-terminal region peptide of mouse Irx3 (Iroquois related homeobox 3) [CSALE VEKKL LKTAF QPVPR RPQNH LDAAL VLSAL SSS] conjugated with KLH. Irx 3 is a transcription factor that is localized in the caudal nerve and expressed in the neural plate during the early development of the central nervous system.
Notice to purchaser
Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.
|
M228
|
Anti-Mouse Rx, Polyclonal |
0.2 mg |
USD $547.00
|
|
|
|
Antibody to neural progenitor cells; detects neurogenesis biomarkers. Use for embryogenesis and stem cell research. This is a rabbit polyclonal antibody raised against three peptide fragments of Rx (Retinal homeobox protein; a homeobox transcription factor that functions in eye development and is expressed early in the eye primordi,) conjugated with KLH.
Notice to purchaser
Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.
|
MA251B
|
Anti-Phospho Histone H2B (Ser14), Mouse Monoclonal Antibody |
100 uL |
USD $543.00
|
|
|
|
An anti-histone antibody for the study of histone modifications related to epigenetic analysis. This antibody can be used for chromatin immunoprecipitation (ChIP) assays. The Anti-Phospho Histone H2B (Ser14) antibody (MA251B) was generated via a 19-amino acid peptide surrounding Ser14 on human histone H2B.
Notice to purchaser
Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.
|
MA312B
|
Anti-Phospho Histone H3 (Ser10), mouse monoclonal antibody |
100 uL |
USD $554.00
|
|
|
|
Anti-histone antibodies for the study of histone modifications related to epigenetic analysis. These antibodies may be used for chromatin immunoprecipitation (ChIP) assays.
Notice to purchaser
Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.
|
M235
|
Anti-Rat Albumin, Monoclonal (Clone R-Alb 214A-1) |
0.1 mg |
USD $449.00
|
|
|
|
Antibody for detection of albumin: Monoclonal antibody was obtained by fusing the mouse myeloma cell line P3U1 with spleen cells from a C57BL/6 mouse after immunization with purified albumin from rat plasma. The monoclonal antibody was harvested from ascitic fluid of a SCID mouse.
Notice to purchaser
Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.
|
MA323B
|
Anti-Trimethyl Histone H3 (Lys27), Mouse Monoclonal Antibody |
100 uL |
USD $543.00
|
|
|
|
Anti-histone antibodies for the study of histone modifications related to epigenetic analysis. These antibodies may be used for chromatin immunoprecipitation (ChIP) assays.
Notice to purchaser
Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.
|
MA333B
|
Anti-Trimethyl Histone H3 (Lys36), Mouse Monoclonal Antibody |
100 uL |
USD $543.00
|
|
|
|
Anti-histone antibodies for the study of histone modifications related to epigenetic analysis. These antibodies may be used for chromatin immunoprecipitation (ChIP) assays.
Notice to purchaser
Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.
|
MA304B
|
Anti-Trimethyl Histone H3 (Lys4), mouse monoclonal antibody |
100 uL |
USD $543.00
|
|
|
|
Anti-histone antibodies for the study of histone modifications related to epigenetic analysis. These antibodies may be used for chromatin immunoprecipitation (ChIP) assays.
Notice to purchaser
Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.
|
MA308B
|
Anti-Trimethyl Histone H3 (Lys9), mouse monoclonal antibody |
100 uL |
USD $543.00
|
|
|
|
Anti-histone antibodies for the study of histone modifications related to epigenetic analysis. These antibodies may be used for chromatin immunoprecipitation (ChIP) assays.
Notice to purchaser
Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.
|
M190
|
Bone Specific Alkaline Phosphatase (Rat), Polyclonal |
0.1 mg |
USD $585.00
|
|
|
|
This product was raised against conjugate of KLH and the peptide (20–49) [PEKEKDPKYWRDQAQETLKYALELQKLNTN] that illustrates an exceptional homology with human and rat Bone Specific Alkaline Phosphatase.
Notice to purchaser
Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.
|
MK115
|
Fibronectin EIA Kit |
96 Assays |
USD $813.00
|
|
|
|
The human Fibronectin EIA Kit is an in vitro enzyme immunoassay (EIA) kit for the specific quantitative determination of human fibronectin in serum, urine, cell culture supernatants, and other biological fluids. This kit is suitable for quantitation of soluble human fibronectin.
Notice to purchaser
Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.
|
MK147
|
Gla/Glu Osteocalcin High Sensitive EIA Set (Rat) |
Each |
USD $1479.00
|
|
|
|
Gla/Glu Osteocalcin High Sensitive EIA Set (Rat; Cat. # MK147) is a combination of Rat Gla-Osteocalcin High Sensitive EIA Kit (Cat.# MK126) and Rat Glu-Osteocalcin High Sensitive EIA Kit (Cat.# MK146). Since both kits have the same capture antibody, they can be used together for simultaneous Gla/Glu detection, thereby making simultaneous monitoring of bone formation and resorption possible.
Notice to purchaser
Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.
|
MK111
|
Gla-Type Osteocalcin (Gla-OC) EIA Kit |
96 Assays |
USD $951.00
|
|
|
|
The Gla-type Osteocalcin EIA Kit is an in vitro enzyme immunoassay (EIA) kit for quantitative determination of human Gla-OC in serum, cultured cell extracts, cell culture supernatants, and other biological fluids.
Notice to purchaser
Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.
|
MK132
|
Human Albumin EIA Kit |
96 Rxns |
USD $813.00
|
|
|
|
This quantification kit using a human albumin-specific monoclonal antibody can be utilized as a simple tool to monitor albumin levels in human serum and body fluids, among other purposes.
Notice to purchaser
Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.
|
MK128
|
Human Gla-Osteocalcin High Sensitive EIA Kit |
96 Rxns |
USD $1193.00
|
|
|
|
This kit is designed to precisely differentiate bovine and human osteocalcins, using a capture antibody-coated plate with a human osteocalcin-specific monoclonal antibody that recognizes the distinct difference in the amino acids at positions 3 and 4 from the N-terminus. This makes possible differential assays of human and bovine osteocalcins. Use of human antigen-specific antibody as a capture monoclonal antibody provides improved linearity when assaying human blood samples. This specificity also enables direct assay of human osteocalcin in the culture supernatant of osteoblasts or differentiated osteoblasts from bone marrow or mesenchymal stem cells cultured in a bovine serum-containing medium, which has been difficult to achieve using the conventional Gla-OC EIA Kit (Cat. #MK111).
Notice to purchaser
Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.
|
MK103
|
Human Vitronectin EIA Kit |
96-Well |
USD $813.00
|
|
|
|
The Human Vitronectin EIA Kit can detect two types of VN protein (65 and 75 kD) in blood using monoclonal antibodies. It can be also used for VN detection in urine and cell culture supernatant. In addition, this kit can also detect vitronectin in rabbit. Because the antibody in this kit does not cross-react with bovine vitronectin antigens, cell culture medium containing fetal bovine serum can be measured directly.
Notice to purchaser
Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.
|
MK114
|
Human/Pig Osteonectin EIA Kit |
96-Well |
USD $813.00
|
|
|
|
This kit is a sandwich-type osteonectin EIA assay based on two monoclonal antibodies, which are derived from bovine and human osteonectin antigens. It enables simple quantification of human, pig, bovine, and rabbit osteonectin.
Notice to purchaser
Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.
|
MK107
|
Laminin EIA Kit |
96 Rxns |
USD $827.00
|
|
|
|
The Laminin EIA Kit is an in vitro enzyme immunoassay (EIA) kit for quantitative determination of human LN in plasma, serum, urine, cultured cell extracts, cell culture supernatants, and other biological fluids.
Notice to purchaser
Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.
|
M226
|
Monoclonal Antibody to Human Albumin |
0.1 mg |
USD $461.00
|
|
|
|
Antibody for detection of albumin: Monoclonal antibody was obtained by fusing the mouse myeloma cell line P3U1 with spleen cells from a BALB/c mouse after immunization with purified human albumin from human plasma.
Notice to purchaser
Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.
|
M225
|
Monoclonal Antibody to Human Alpha Fetoprotein |
0.1 mg |
USD $449.00
|
|
|
|
Antibody for detection of alpha-fetoprotein (AFP): Monoclonal antibody was obtained by fusing the mouse myeloma cell-line P3U1 with spleen cells of BALB/c mouse after immunization with purified human alpha fetoprotein from human plasma.
Notice to purchaser
Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.
|
M201
|
Monoclonal Antibody to TF (Trigger Factor) |
0.1 mg |
USD $463.00
|
|
|
|
Monoclonal antibody to Trigger Factor (TF) molecular chaperone; can be used for western blotting or immunoprecipitation of TF-tagged recombinant proteins. This antibody was obtained by fusing the P3U1 myeloma cell line with lymph node cells from a C57BL/6 mouse after immunization with synthetic peptide (165–178)[ TIDFTGSVDGEEFE] of Trigger Factor (a chaperon protein derived from E. coli) conjugated with KLH. The monoclonal antibody was harvested from ascitic fluid from a SCID mouse.
Notice to purchaser
Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.
|
M041
|
Monoclonal Anti-Bovine Osteocalcin (Clone OC4-30) |
0.1 mg |
USD $512.00
|
|
|
|
This clone was raised against bovine osteocalcin, and equally recognizes both the bovine and the human osteocalcins. Clone OC4-30 is specific for γ-carboxylated osteocalcin.
Notice to purchaser
Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.
|
M042
|
Monoclonal Anti-Bovine Osteocalcin (Clone OCG2) |
0.1 mg |
USD $515.00
|
|
|
|
This clone was raised against bovine osteocalcin, and equally recognizes both the bovine and the human osteocalcins.
Notice to purchaser
Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.
|
M043
|
Monoclonal Anti-Bovine Osteocalcin (Clone OCG3) |
0.1 mg |
USD $515.00
|
|
|
|
This clone was raised against bovine osteocalcin, and equally recognizes both the bovine and the human osteocalcins.
Notice to purchaser
Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.
|
M044
|
Monoclonal Anti-Bovine Osteocalcin (Clone OCG4) |
0.1 mg |
USD $515.00
|
|
|
|
This clone was raised against bovine osteocalcin, and equally recognizes both the bovine and the human osteocalcins.
Notice to purchaser
Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.
|
M110
|
Monoclonal Anti-chicken N-Cadherin (Clone NCD-2) |
0.1 mg |
USD $461.00
|
|
|
|
Cadherins are transmembrane glycoproteins of 723–747 amino acids that function as Ca2+-dependent adhesion receptors and are responsible for tight intercellular connections. Members of the cadherin family include: E- (epithelial), P- (placental), and N- (neural) cadherin, which share a common basic structure but show distinct patterns of expression in tissues. The specific binding properties of each member controls selective cell-to-cell adhesion. Regulated expression of the members during development implicates involvement in morphogenesis. Cadherins may also be involved with tumor invasion and metastasis. MAb clones originate from relevant hybridoma cells constructed by fusion between splenocytes of immunized hosts and P3-X63-Ag8 myelomas. NCD-2 was purified from serum-free culture supernatant.
Notice to purchaser
Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.
|
M106
|
Monoclonal Anti-Human E-cadherin (Clone HECD-1) |
0.1 mg |
USD $461.00
|
|
|
|
Cadherins are transmembrane glycoproteins of 723–747 amino acids that function as Ca2+-dependent adhesion receptors and are responsible for tight intercellular connections. Members of the cadherin family include: E- (epithelial), P- (placental), and N- (neural) cadherin, which share a common basic structure but show distinct patterns of expression in tissues. The specific binding properties of each member controls selective cell-to-cell adhesion. Regulated expression of the members during development implicates involvement in morphogenesis. Cadherins may also be involved with tumor invasion and metastasis. MAb clones originate from relevant hybridoma cells constructed by fusion between splenocytes of immunized hosts and P3-X63-Ag8 myelomas. HECD-1 was purified from ascitic fluid.
Notice to purchaser
Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.
|
M126
|
Monoclonal Anti-Human E-cadherin (Clone SHE78-7) |
0.1 mg |
USD $461.00
|
|
|
|
Cadherins are transmembrane glycoproteins of 723–747 amino acids that function as Ca2+-dependent adhesion receptors and are responsible for tight intercellular connections. Members of the cadherin family include: E- (epithelial), P- (placental), and N- (neural) cadherin, which share a common basic structure but show distinct patterns of expression in tissues. The specific binding properties of each member controls selective cell-to-cell adhesion. Regulated expression of the members during development implicates involvement in morphogenesis. Cadherins may also be involved with tumor invasion and metastasis. MAb clones originate from relevant hybridoma cells constructed by fusion between splenocytes of immunized hosts and P3-X63-Ag8 myelomas. SHE78-7 was purified from ascitic fluid.
Notice to purchaser
Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.
|
M002
|
Monoclonal Anti-Human Fibronectin (Clone FN12-8) |
0.4 mg |
USD $477.00
|
|
|
|
These clones were raised against purified human plasma fibronectin. Each recognizes discrete epitopes of fibronectin. For antibody Western blots or histology, clone FN30-8 works best and is also effective for adhesion blockade studies. Clones FN12-8 and FNH3-8 are unique in that they can be used for studies related to fibrin and heparin interactions, respectively.
Notice to purchaser
Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.
|
M010
|
Monoclonal Anti-Human Fibronectin (Clone FN30-8) |
0.4 mg |
USD $477.00
|
|
|
|
These clones were raised against purified human plasma fibronectin. Each recognizes discrete epitopes of fibronectin. For antibody Western blots or histology, clone FN30-8 works best and is also effective for adhesion blockade studies. Clones FN12-8 and FNH3-8 are unique in that they can be used for studies related to fibrin and heparin interactions, respectively.
Notice to purchaser
Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.
|
M145
|
Monoclonal Anti-Human Influenza A (H1N1, H2N2) (Clone C179) |
0.1 mg |
USD $449.00
|
|
|
|
Influenza virus is classified into three groups (A, B, and C). Clinically prevalent types of Influenza virus are H1, H3 and B strain. Influenza virus is further classified into subtypes based on variances in Neuraminidase (NA) and Haemagglutinin (HA) that are the surface glycoprotein of the virus. H1N1 subtype and H3N2 subtype are known to cause severe febrile illness. An influenza virus particle consists of a head region and a stem region. The head region has a receptor domain and the stem region contains a region required for fusion between the virus and the target cell. Takara offers several influenza antibodies that are useful for various viral detection and typing methods, as well as neutralization assays. These antibodies are for research use only.
Notice to purchaser
Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.
|
M146
|
Monoclonal Anti-Human Influenza A (H3N2) (Clone F49) |
0.1 mg |
USD $449.00
|
|
|
|
Influenza virus is classified into three groups (A, B, and C). Clinically prevalent types of Influenza virus are H1, H3 and B strain. Influenza virus is further classified into subtypes based on variances in Neuraminidase (NA) and Haemagglutinin (HA) that are the surface glycoprotein of the virus. H1N1 subtype and H3N2 subtype are known to cause severe febrile illness. An influenza virus particle consists of a head region and a stem region. The head region has a receptor domain and the stem region contains a region required for fusion between the virus and the target cell. Takara offers several influenza antibodies that are useful for various viral detection and typing methods, as well as neutralization assays. These antibodies are for research use only.
Notice to purchaser
Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.
|
M148
|
Monoclonal Anti-Human Influenza B (Clone 9D6) |
0.1 mg |
USD $449.00
|
|
|
|
Influenza virus is classified into three groups (A, B, and C). Clinically prevalent types of Influenza virus are H1, H3 and B strain. Influenza virus is further classified into subtypes based on variances in Neuraminidase (NA) and Haemagglutinin (HA) that are the surface glycoprotein of the virus. H1N1 subtype and H3N2 subtype are known to cause severe febrile illness. An influenza virus particle consists of a head region and a stem region. The head region has a receptor domain and the stem region contains a region required for fusion between the virus and the target cell. Takara offers several influenza antibodies that are useful for various viral detection and typing methods, as well as neutralization assays. These antibodies are for research use only.
Notice to purchaser
Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.
|
M020
|
Monoclonal Anti-Human Laminin (Clone LN82-13) |
0.1 mg |
USD $515.00
|
|
|
|
This antibody is designed to detect laminin using western blotting analysis under non-reducing and non-heating conditions and for histology on frozen tissue sections and paraffin embedded tissue sections.
Notice to purchaser
Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.
|
M184
|
Monoclonal Anti-Human Osteocalcin (Clone 5-12H) |
0.1 mg |
USD $515.00
|
|
|
|
This monoclonal antibody was obtained by fusing the mouse myeloma cell-line P3U1 with spleen cells of C57BL6 mouse after immunization with KLH-conjugated peptide from human osteocalcin sequence (amino acids 1-6 YLYQWL). The monoclonal antibody was harvested from scid mouse ascitic fluid.
Notice to purchaser
Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.
|
M127
|
Monoclonal Anti-Human P-cadherin (Clone NCC-CAD-299) |
0.1 mg |
USD $461.00
|
|
|
|
Cadherins are transmembrane glycoproteins of 723–747 amino acids that function as Ca2+-dependent adhesion receptors and are responsible for tight intercellular connections. Members of the cadherin family include: E- (epithelial), P- (placental), and N- (neural) cadherin, which share a common basic structure but show distinct patterns of expression in tissues. The specific binding properties of each member controls selective cell-to-cell adhesion. Regulated expression of the members during development implicates involvement in morphogenesis. Cadherins may also be involved with tumor invasion and metastasis. MAb clones originate from relevant hybridoma cells constructed by fusion between splenocytes of immunized hosts and P3-X63-Ag8 myelomas. NCC-CAD-299 was purified from ascitic fluid.
Notice to purchaser
Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.
|
M011
|
Monoclonal Anti-Human Procollagen Type I C-Peptide (PIP) (Clone PC5-5) |
0.1 mg |
USD $488.00
|
|
|
|
Collagens (types I, II, III, IV and V) are synthesized as precursor molecules called procollagens. These contain propeptide sequences, at both the amino-terminal and the carboxy-terminal ends. The function of these propeptides is to facilitate the winding of procollagen molecules into a triple-helical conformation within the endoplasmic reticulum. The propeptides are cleaved off from the collagen triple helix molecule during its secretion. The triple helix collagens then polymerize into extracellular collagen fibrils. Clones PC5-5 and PC8-7 recognize procollagen type I C-peptide. They are suitable for the detection of non-denatured antigen released in tissue culture media and for monitoring of collagen synthesis.
Notice to purchaser
Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.
|
M012
|
Monoclonal Anti-Human Procollagen Type I C-Peptide (PIP) (Clone PC8-7) |
0.1 mg |
USD $477.00
|
|
|
|
Collagens (types I, II, III, IV and V) are synthesized as precursor molecules called procollagens. These contain propeptide sequences, at both the amino-terminal and the carboxy-terminal ends. The function of these propeptides is to facilitate the winding of procollagen molecules into a triple-helical conformation within the endoplasmic reticulum. The propeptides are cleaved off from the collagen triple helix molecule during its secretion. The triple helix collagens then polymerize into extracellular collagen fibrils.
Clones PC5-5 and PC8-7 recognize procollagen type I C-peptide. They are suitable for the detection of non-denatured antigen released in tissue culture media and for monitoring of collagen synthesis.
Notice to purchaser
Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.
|
M171
|
Monoclonal Anti-Human Undercarboxylated Osteocalcin (Clone GluOC4-5) |
0.1 mg |
USD $515.00
|
|
|
|
This clone was raised against human osteocalcin peptide. It specifically recognizes human osteocalcin with decarboxylated glutamic acid residues, and does not recognize Gla-type osteocalcin.
Notice to purchaser
Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.
|
M017
|
Monoclonal Anti-Human Vitronectin (Clone VN58-1) |
0.2 mg |
USD $477.00
|
|
|
|
This monoclonal antibody was raised against purified human vitronectin. It may be used for Western blots or histology on frozen sections or paraffin embedded tissue. Clone VN58-1 does not interfere with the cell-binding activity of vitronectin.
Notice to purchaser
Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.
|
M029
|
Monoclonal Anti-Human von Willebrand Factor (vWF) (Clone VW92-3) |
0.2 mg |
USD $477.00
|
|
|
|
Clone VW92-3 was obtained using a V8 Protease III fragment of human plasma von Willebrand factor as immunogen. This antibody specifically recognizes human von Willebrand factor and does not cross react with bovine von Willebrand factor.
Notice to purchaser
Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.
|
M147
|
Monoclonal Anti-Influenza A (H1, H2, H3) (Clone C111) |
0.1 mg |
USD $452.00
|
|
|
|
Influenza virus is classified into three groups (A, B, and C). Clinically prevalent types of Influenza virus are H1, H3 and B strain. Influenza virus is further classified into subtypes based on variances in Neuraminidase (NA) and Haemagglutinin (HA) that are the surface glycoprotein of the virus. H1N1 subtype and H3N2 subtype are known to cause severe febrile illness. An influenza virus particle consists of a head region and a stem region. The head region has a receptor domain and the stem region contains a region required for fusion between the virus and the target cell. Takara offers several influenza antibodies that are useful for various viral detection and typing methods, as well as neutralization assays. These antibodies are for research use only.
Notice to purchaser
Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.
|
M107
|
Monoclonal Anti-mouse E-cadherin (Clone ECCD-1) |
0.1 mg |
USD $461.00
|
|
|
|
Cadherins are transmembrane glycoproteins of 723–747 amino acids that function as Ca2+-dependent adhesion receptors and are responsible for tight intercellular connections. Members of the cadherin family include: E- (epithelial), P- (placental), and N- (neural) cadherin, which share a common basic structure but show distinct patterns of expression in tissues. The specific binding properties of each member controls selective cell-to-cell adhesion. Regulated expression of the members during development implicates involvement in morphogenesis. Cadherins may also be involved with tumor invasion and metastasis. MAb clones originate from relevant hybridoma cells constructed by fusion between splenocytes of immunized hosts and P3-X63-Ag8 myelomas. ECCD-1 was purified from serum-free culture supernatant.
Notice to purchaser
Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.
|
M108
|
Monoclonal Anti-mouse E-cadherin (Clone ECCD-2) |
0.1 mg |
USD $470.00
|
|
|
|
Cadherins are transmembrane glycoproteins of 723–747 amino acids that function as Ca2+-dependent adhesion receptors and are responsible for tight intercellular connections. Members of the cadherin family include: E- (epithelial), P- (placental), and N- (neural) cadherin, which share a common basic structure but show distinct patterns of expression in tissues. The specific binding properties of each member controls selective cell-to-cell adhesion. Regulated expression of the members during development implicates involvement in morphogenesis. Cadherins may also be involved with tumor invasion and metastasis. MAb clones originate from relevant hybridoma cells constructed by fusion between splenocytes of immunized hosts and P3-X63-Ag8 myelomas. ECCD-2 was purified from serum-free culture supernatant.
Notice to purchaser
Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.
|
M188
|
Monoclonal Anti-Mouse Osteocalcin (Clone R21C-01A) |
0.1 mg |
USD $515.00
|
|
|
|
Monoclonal antibody was obtained by fusing the mouse myeloma cell-line P3U1 with spleen cells of SD rat after immunization with KLH-conjugated peptide from mouse osteocalcin sequence (amino acids 25–46 CDELSDQYGLKTAYKRIYGITI). The monoclonal antibody was harvested from ascites fluid of scid mouse.
Notice to purchaser
Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.
|
M109
|
Monoclonal Anti-mouse P-cadherin (Clone PCD-1 ) |
0.1 mg |
USD $461.00
|
|
|
|
Cadherins are transmembrane glycoproteins of 723–747 amino acids that function as Ca2+-dependent adhesion receptors and are responsible for tight intercellular connections. Members of the cadherin family include: E- (epithelial), P- (placental), and N- (neural) cadherin, which share a common basic structure but show distinct patterns of expression in tissues. The specific binding properties of each member controls selective cell-to-cell adhesion. Regulated expression of the members during development implicates involvement in morphogenesis. Cadherins may also be involved with tumor invasion and metastasis. MAb clones originate from relevant hybridoma cells constructed by fusion between splenocytes of immunized hosts and P3-X63-Ag8 myelomas. PCD-1 was purified from serum-free culture supernatant.
Notice to purchaser
Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.
|
M125
|
Monoclonal Anti-Osteonectin/SPARC (Clone ON1-1) |
0.1 mg |
USD $512.00
|
|
|
|
This clone was raised against bone-derived bovine osteonectin (ON1-1) and human platelet derived osteonectin (OSN4-2). It reacts with thrombin-stimulated platelets, not with non-stimulated platelets.
Notice to purchaser
Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.
|
M124
|
Monoclonal Anti-Osteonectin/SPARC (Clone OSN4-2) |
0.1 mg |
USD $515.00
|
|
|
|
This clone was raised against bone-derived bovine osteonectin (ON1-1) and human platelet derived osteonectin (OSN4-2). It reacts with thrombin-stimulated platelets, not with non-stimulated platelets.
Notice to purchaser
Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.
|
M200
|
Monoclonal Anti-Pro S2, (Clone ProS 7B-8F) |
0.1 mg |
USD $610.00
|
|
|
|
Anti-Protein S is a monoclonal antibody used for detection of ProS2-fused protein expressed by using pCold ProS2 DNA. ProS2 is about 23 kDa of a solubilization tag which is a tandem-dimer of the N-terminal domain of Protein S, a soluble protein derived from myxobacteria Myxococcus xanthus.
Notice to purchaser
Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.
|
M192
|
Monoclonal Anti-Rat Collagen type II (Clone Col II 2B-11F) |
0.1 mg |
USD $515.00
|
|
|
|
Monoclonal antibody was produced from an established hybridoma obtained by fusing the mouse myeloma cell line P3U1 with lympho cells from a C57BL/6 mouse after immunization with rat collagen type II. The monoclonal antibody was harvested from ascitic fluid of a SCID mouse.
Notice to purchaser
Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.
|
M186
|
Monoclonal Anti-Rat Osteocalcin (Clone 6-7H) |
0.1 mg |
USD $515.00
|
|
|
|
This monoclonal antibody was obtained by fusing the mouse myeloma cell-line P3U1 with spleen cells from a BALB/c mouse after immunization with a KLH-conjugated peptide from rat osteocalcin (amino acids 1–25: YLNNGLGAPAPYPDPLEPHREVCEL). The monoclonal antibody was harvested from ascitic fluid.
Notice to purchaser
Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.
|
M187
|
Monoclonal Anti-Rat Osteocalcin (Clone 9-12H) |
0.1 mg |
USD $515.00
|
|
|
|
This monoclonal antibody was obtained by fusing the mouse myeloma cell-line P3U1 with spleen cells from a BALB/c mouse after immunization with a KLH-conjuagated peptide from rat osteocalcin (amino acids 38–50: FQDAYKRIYGTTV). The monoclonal antibody was harvested from ascitic fluid.
Notice to purchaser
Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.
|
M185
|
Monoclonal Anti-Rat Osteocalcin (Clone D-8G) |
0.1 mg |
USD $515.00
|
|
|
|
This monoclonal antibody was obtained by fusing the mouse myeloma cell line P3U1 with spleen cells from a BALB/c mouse after immunization with a KLH-conjugated peptide from rat osteocalcin (amino acids 1–25: YLNNGLGAPAPYPDPLEPHREVCEL). The monoclonal antibody was harvested from ascitic fluid.
Notice to purchaser
Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.
|
MK133
|
Mouse Albumin EIA Kit |
96-Well |
USD $813.00
|
|
|
|
This product is a sandwich-type mouse albumin assay kit that uses two rat monoclonal antibodies generated against mouse albumin. The kit makes it possible to easily measure mouse albumin in vitro and in vivo. Since the assay is performed using monoclonal antibodies, it provides excellent specificity because these antibodies do not cross-react with albumin from other species.
Notice to purchaser
Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.
|
MK127
|
Mouse Gla-Osteocalcin High Sensitive EIA Kit |
96 Rxns |
USD $915.00
|
|
|
|
The Mouse Gla-Osteocalcin High Sensitive EIA Kit is an quantitative kit that enables specific and highly sensitive assay of mouse Gla-osteocalcin that exhibits a potential to osseointegration (active osteocalcin). The capture antibody (plate-bound antibody) is a plate-bound solid-phased rat monoclonal antibody that specifically recognizes the C-terminal region of mouse osteocalcin. It is paired with labeled antibody-a monoclonal antibody for detecting osteocalcin with Gla residues. Because mouse osteocalcin has C terminal region sequences that differ from those in humans, cattle and other large animals, it is possible to measure mouse osteocalcin without any cross-reaction with bovine antigens through capture of the antigen with antibodies recognizing a C-terminal epitope. Therefore, one can monitor the process of osteoblastic cell differentiation from pluripotent cells such as mouse ES and iPS cells without interference from bovine serum included in the culture medium.
Notice to purchaser
Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.
|
MK129
|
Mouse Glu-Osteocalcin High Sensitive EIA Kit |
96 Rxns |
USD $1193.00
|
|
|
|
The Mouse Glu-Osteocalcin High Sensitive EIA Kit is an quantitative kit that enables specific and highly sensitive assay of decarboxylated osteocalcin from mouse bone tissue by enzymes present in osteoclasts and Glu-type osteocalcin (inactive osteocalcin) that has been produced by osteoblasts but has not undergone carboxylation. Because mouse osteocalcin has C terminal sequences that differ from those in humans, cattle, and other large animals, it is possible to measure mouse osteocalcin without cross-reaction with bovine antigens by using antibodies that recognize C-terminal epitopes. Therefore, it is possible to monitor osteoblastic cell differentiation from pluripotent cells such as mouse ES and iPS cells without interference from bovine serum included in the culture medium. Bone turnover can also be analyzed by simultaneously measuring Gla-type and Glu-type osteocalcin. Gla-type osteocalcin can be evaluated using the Mouse Gla-Osteocalcin High Sensitive EIA Kit (Cat. #MK127), which includes a monoclonal antibody that specifically recognizes the Gla residues of osteocalcin.
Notice to purchaser
Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.
|
MK139
|
Pig Gla-Osteocalcin EIA Kit |
96 Rxns |
USD $871.00
|
|
|
|
The Pig Gla-Osteocalcin EIA Kit is a quantitative kit that enables specific and highly sensitive assay of porcine Gla-osteocalcin that exhibits a potential to osseointegration (active osteocalcin). The capture antibody (plate-bound antibody) is a plate-bound solid-phased monoclonal antibody that specifically recognizes the Gla residue at position 17 on osteocalcin. It is paired with a labeled antibody—a monoclonal antibody for detecting porcine osteocalcin. The concurrent measurement of undercarboxylated porcine osteocalcin (Glu-osteocalcin) may be achieved with the Pig Glu-Osteocalcin EIA Kit (Cat. #MK149) to monitor both bone formation and bone resorption based on a relative evaluation of Gla/Glu-osteocalcins.
Notice to purchaser
Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.
|
M149
|
Polyclonal Antibody to Human Influenza A, B (Rabbit Polyclonal) |
0.4 mg |
USD $356.00
|
|
|
|
Influenza virus is classified into three groups (A, B, and C). Clinically prevalent types of Influenza virus are H1, H3 and B strain. Influenza virus is further classified into subtypes based on variances in Neuraminidase (NA) and Haemagglutinin (HA) that are the surface glycoprotein of the virus. H1N1 subtype and H3N2 subtype are known to cause severe febrile illness. An influenza virus particle consists of a head region and a stem region. The head region has a receptor domain and the stem region contains a region required for fusion between the virus and the target cell. Takara offers several influenza antibodies that are useful for various viral detection and typing methods, as well as neutralization assays. These antibodies are for research use only.
Notice to purchaser
Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.
|
M195
|
Polyclonal Antibody to Mouse Otp |
100 uL |
USD $547.00
|
|
|
|
Antibody to neural progenitor cells; detects neurogenesis biomarkers. Use for embryogenesis and stem cell research. Otp is a guinea pig polyclonal antibody raised against C-terminal region peptide [LRRKA LEHTV SMSFT] of mouse Otp (homeobox protein Orthopedia; a marker of the hindbrain and hypothalamic neurons during embryonic development ) conjugated with KLH.
Notice to purchaser
Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.
|
M176
|
Polyclonal Anti-Dentin Matrix Protein-I (DMP-1) |
0.1 mg |
USD $554.00
|
|
|
|
This product is a rabbit polyclonal antibody raised against an N-terminal region of rat Dentin Matrix Protein-1.
Notice to purchaser
Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.
|
M173
|
Polyclonal Anti-Mouse Osteocalcin (Clone mOC(1-20)) |
0.1 mg |
USD $515.00
|
|
|
|
This product was raised against N-terminal peptide of mouse osteocalcin, and specifically recognizes mouse osteocalcin. It does not cross react with rat osteocalcin.
Notice to purchaser
Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.
|
M142
|
Polyclonal Anti-N-cadherin |
0.4 mg |
USD $376.00
|
|
|
|
Cadherins are transmembrane glycoproteins of 723–747 amino acids that function as Ca2+-dependent adhesion receptors and are responsible for tight intercellular connections. Members of the cadherin family include: E- (epithelial), P- (placental), and N- (neural) cadherin, which share a common basic structure but show distinct patterns of expression in tissues. The specific binding properties of each member controls selective cell-to-cell adhesion. Regulated expression of the members during development implicates involvement in morphogenesis. Cadherins may also be involved with tumor invasion and metastasis. MAb clones originate from relevant hybridoma cells constructed by fusion between splenocytes of immunized hosts and P3-X63-Ag8 myelomas. This polyclonal antibody was purified from serum-free culture supernatant.
Notice to purchaser
Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.
|
MK101
|
Procollagen Type I C-Peptide (PIP) EIA Kit |
96 Assays |
USD $811.00
|
|
|
|
The Procollagen Type I C-peptide EIA Kit is an in vitro enzyme immunoassay (EIA) kit for the quantification of human, bovine, canine, horse, or monkey PIP in plasma, serum, cultured cell extracts, cell culture supernatants, or other biological fluids.
Notice to purchaser
Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.
|
MK126
|
Rat Gla-Osteocalcin High Sensitive EIA Kit |
96 Rxns |
USD $915.00
|
|
|
|
Rat Gla-Osteocalcin High Sensitive EIA Kit is a sandwich-type EIA kit which uses a rat osteocalcin C-terminus-specific antibody as capture-antibody on a solid-phase plate. This antibody has a minimal cross reactivity with bovine, human and rabbit osteocalcin. An enzyme-labeled antibody (GlaOC4-30) specific to Gla-OC is used as the detection antibody, allowing this kit to detect Gla-osteocalcin with a very high sensitivity. As such, this EIA kit is sensitive enough to detect even minute levels of rat osteocalcin produced in supernatants of cells cultured in fetal calf serum-supplemented medium.
Notice to purchaser
Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.
|
MK146
|
Rat Glu-Osteocalcin High Sensitive EIA Kit |
96 Rxns |
USD $915.00
|
|
|
|
Rat Glu-Osteocalcin High Sensitive EIA Kit is a sandwich-type EIA kit in which rat osteocalcin C terminal region recognition specific antibody is the capture antibody on a solid plate and a monoclonal antibody that is specific to the Glu residues that straddle positions 21 and 24 of osteocalcin is arranged as the detection antibody. This product makes high-sensitivity measurement of minor antigens and maintenance of stable reproducibility possible. The use of a 96-well plate makes it possible to assay many sample treatments. Moreover, as it has the same capture antibody as the Rat Gla-Osteocalcin High Sensitive EIA Kit (Cat. #MK126), the kits may be used together for simultaneous Gla/Glu detection, thereby making simultaneous monitoring of bone formation and resorption possible.
Notice to purchaser
Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.
|
Y40400
|
STEM101™ |
50 ug |
USD $330.00
|
|
|
|
STEM101 reacts specifically with a protein located in the nucleus of human cells. This antibody detects cells from a variety of human tissues including brain. This antibody does not cross-react with brain tissue or extracts from mouse or rat.
Notice to purchaser
Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.
|
Y40410
|
STEM121™ |
50 ug |
USD $330.00
|
|
|
|
STEM121 reacts specifically with a cytoplasmic protein of human cells. This marker is expressed in cells from a variety of tissues including brain, liver and pancreas. However, it is expressed most highly in central nervous system (CNS) cells. This antibody does not cross-react with brain tissue or extracts from mouse, rat, or cynomologous monkey.
Notice to purchaser
Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.
|
Y40420
|
STEM123™ |
50 ug |
USD $333.00
|
|
|
|
STEM123 reacts specifically with glial fibrillary acidic protein (GFAP) of human cells. GFAP is an intermediate-filament protein that is highly expressed in astrocytes and other cells of astroglial lineage. This antibody does not cross-react with brain tissue or extracts from mouse or rat.
Notice to purchaser
Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.
|
MK301
|
TRACP and ALP Assay Kit |
500 Rxns |
USD $537.00
|
|
|
|
TRACP & ALP Assay Kit allows for simultaneous detection of 2 enzymes which are involved in bone metabolism. TRACP which is an osteoclast enzyme marker and ALP an osteoblast enzyme marker. TRACP & ALP Assay Kit has been designed for simple and quick detection of ACP (Acid phosphatase) and ALP (Alkaline phosphatase) through the use of pNPP (p-nitro-phenyl phosphate) substrate. The addition of tartaric acid into the ACP assay, allows for the detection of TRACP (tartrate-resistant acid phosphatase) activity. Since this kit utilizes an aqueous substrate, it enables quick activity quantification by measuring the absorbance of the reactant. In addition to this kit, TRACP & ALP double-staining Kit (Cat. #MK300) is also available using a non-soluble substrate. The appropriate kit can be selected depending on assay interest.
Notice to purchaser
Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.
|
MK300
|
TRACP and ALP Double-Stain Kit |
120 Wells |
USD $429.00
|
|
|
|
This product is a staining kit for bone-related cells. Chromogenic substrates for alkaline phosphatase, an enzyme marker of osteoblasts, and tartrate-resistant acid phosphatase, an enzyme marker of osteoclasts, are combined with a reagent for nuclear staining that provides visualization of multinucleated osteoclasts. Both acid and alkaline phosphatase activities in the cells can be stained simultaneously for comparison. Moreover, as the substrates are provided as premixed reagents, the substrate solutions can be easily prepared.
Notice to purchaser
Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.
|
MK118
|
Undercarboxylated Osteocalcin (Glu-OC) EIA Kit |
96 Rxns |
USD $970.00
|
|
|
|
The Undercarboxylated Osteocalcin (Glu-OC) EIA Kit uses two monoclonal antibodies that are highly specific for undercarboxylated osteocalcin (Glu-OC); one of these antibodies is attached to the assay plate and the other is peroxidase-linked. Direct measurement of Glu-OC by the Undercarboxylated Osteocalcin (Glu-OC) EIA Kit provides accurate bone metabolism data without the need for radioactivity. Furthermore, the Undercarboxylated Osteocalcin (Glu-OC) EIA Kit can be used in conjunction with the Gla-Type Osteocalcin (Gla-OC) EIA Kit (Cat. #MK111) to obtain more complete bone metabolism data.
Notice to purchaser
Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.
|
MK410
|
Universal Tyrosine Kinase Assay Kit |
96 Assays |
USD $429.00
|
|
|
|
Universal Tyrosine Kinase Assay Kit enables measurement of the activity of PTK over a wide range, quickly and specifically and with non-RI chemicals. This kit is useful for analysis of the regulation of PTK activity by using recombinant PTK and for the in vitro screening of PTK inhibitors.
Notice to purchaser
Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.
|